N6MT1_MOUSE Q6SKR2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6SKR2
Recommended name：Methyltransferase N6AMT1
EC number：EC 2.1.1.-
Alternative names：(HemK methyltransferase family member 2) (Lysine N-methyltransferase 9) (Methylarsonite methyltransferase N6AMT1) (Protein N(5)-glutamine methyltransferase) (EC 2.1.1.-)
Cleaved into：
GeneID：67768
Gene names (primary )：N6amt1
Gene names (synonym )：Hemk2 Kmt9 Pred28
Gene names (ORF )：
Length：214
Mass：22984
Sequence：MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPRALYMCTDINPEAAACTLETARCNRVHVQPVITDLVHGLLPRLKGKVDLLVFNPPYVVTPPEEVGSRGIEAAWAGGRNGREVMDRFFPLAPELLSPRGLFYLVTVKENNPEEIFKTMKTRGLQGTTALCRQAGQEALSVLRFSKS
Tissue specificity：Highly expressed in undifferentiated embryonic stem cells (at protein level) (PubMed:19116772). Also expressed in testis and brain, weakly expressed in differentiated embryonic stem cells and kidney (PubMed:19116772). Not expressed in muscle, heart, placenta, pancreas, lung and stomach (PubMed:19116772). {ECO:0000269|PubMed:19116772}.
Induction：
Developmental stage：
Protein families：Eukaryotic/archaeal PrmC-related family